KLRC1 Polyclonal AntibodyKLRC1 Polyclonal Antibody
Move your mouse over image or click to enlarge

KLRC1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14014-200ul 200ul
£332.50
A14014-100ul 100ul
£192.50
A14014-50ul 50ul
£113.75
A14014-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14014
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KLRC1; CD159A; NKG2; NKG2A; killer cell lectin like receptor C1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 96-215 of human KLRC1 (NP_015567.1).
Reactivity Human
Gene ID 3821
Calculated MW 24kDa/26kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence RHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents