KIF19 Polyclonal AntibodyKIF19 Polyclonal Antibody
Move your mouse over image or click to enlarge

KIF19 Polyclonal Antibody

Cat# Size Price Qty Buy
A13868-200ul 200ul
£332.50
A13868-100ul 100ul
£192.50
A13868-50ul 50ul
£113.75
A13868-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13868
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KIF19; KIF19A; kinesin family member 19
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human KIF19 (NP_694941.2).
Reactivity Human, Mouse, Rat
Gene ID 124602
Calculated MW 57kDa/61kDa/111kDa
Observed MW 111kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDQEPGIYVQTLNDLFRAIEETSNDMEYEVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKNILQEVRQGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents