KHDRBS2 Polyclonal AntibodyKHDRBS2 Polyclonal Antibody
Move your mouse over image or click to enlarge

KHDRBS2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15969-20ul 20ul
£77.00
A15969-50ul 50ul
£113.75
A15969-100ul 100ul
£192.50
A15969-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15969
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KHDRBS2; SLM-1; SLM1; KH RNA binding domain containing, signal transduction associated 2
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human KHDRBS2 (NP_689901.2).
Reactivity Human
Gene ID 202559
Calculated MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents