KCNJ4 Polyclonal AntibodyKCNJ4 Polyclonal Antibody
Move your mouse over image or click to enlarge

KCNJ4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14010-200ul 200ul
£332.50
A14010-100ul 100ul
£192.50
A14010-50ul 50ul
£113.75
A14010-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14010
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KCNJ4; HIR; HIRK2; HRK1; IRK-3; IRK3; Kir2.3; inward rectifier potassium channel 4
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ4 (NP_004972.1).
Reactivity Human, Mouse, Rat
Gene ID 3761
Calculated MW 49kDa
Observed MW 49kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAV
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents