KCNIP1 Polyclonal AntibodyKCNIP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

KCNIP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4684-200ul 200ul
£332.50
A4684-100ul 100ul
£192.50
A4684-50ul 50ul
£113.75
A4684-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4684
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KCNIP1; KCHIP1; VABP; Kv channel-interacting protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-216 of human KCNIP1 (NP_055407.1).
Reactivity Human, Mouse, Rat
Gene ID 30820
Calculated MW 21kDa/22kDa/26kDa/27kDa
Observed MW 27-37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents