JARID1B Polyclonal AntibodyJARID1B Polyclonal Antibody
Move your mouse over image or click to enlarge

JARID1B Polyclonal Antibody

Cat# Size Price Qty Buy
A14104-200ul 200ul
£332.50
A14104-100ul 100ul
£192.50
A14104-50ul 50ul
£113.75
A14104-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14104
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names KDM5B; CT31; JARID1B; PLU-1; PLU1; PPP1R98; PUT1; RBBP2H1A; RBP2-H1; lysine demethylase 5B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 784-883 of human JARID1B (NP_006609.3).
Reactivity Human, Mouse, Rat
Gene ID 10765
Calculated MW 175kDa/179kDa
Observed MW 176kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents