ITPKB Polyclonal AntibodyITPKB Polyclonal Antibody
Move your mouse over image or click to enlarge

ITPKB Polyclonal Antibody

Cat# Size Price Qty Buy
A3929-200ul 200ul
£332.50
A3929-100ul 100ul
£192.50
A3929-50ul 50ul
£113.75
A3929-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3929
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ITPKB; IP3-3KB; IP3K; IP3K-B; IP3KB; PIG37; inositol-trisphosphate 3-kinase B
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human ITPKB (NP_002212.3).
Reactivity Human, Mouse, Rat
Gene ID 3707
Calculated MW 67kDa/102kDa
Observed MW 102kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSPGRGASFLFPPAESLSPEEPRSPGGWRSGRRRLNSSSGSGSGSSGSSVSSPSWAGRLRGDRQQVVAAGTLSPPGPEEAKRKLRILQRELQNVQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSPSPCPFRSSSQPPGRVLVQGARSEERRTKSWGEQCPETSGTDSGRKGGPSLCSSQVKKGMPPLPGRAAPTGSEAQGPSAFVRMEKG
Sensitivity WB,1:200 - 1:2000|IHC,1:20 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents