INTS10 Polyclonal AntibodyINTS10 Polyclonal Antibody
Move your mouse over image or click to enlarge

INTS10 Polyclonal Antibody

Cat# Size Price Qty Buy
A13419-200ul 200ul
£332.50
A13419-100ul 100ul
£192.50
A13419-50ul 50ul
£113.75
A13419-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13419
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names INTS10; C8orf35; INT10; integrator complex subunit 10
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 451-710 of human INTS10 (NP_060612.2).
Reactivity Human, Mouse
Gene ID 55174
Calculated MW 82kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FLTDMIIYQGQYKKAIASLHHLAALQGSISQPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRGENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCINEKILLLQTLT
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents