IL1A Polyclonal AntibodyIL1A Polyclonal Antibody
Move your mouse over image or click to enlarge

IL1A Polyclonal Antibody

Cat# Size Price Qty Buy
A1316-200ul 200ul
£332.50
A1316-100ul 100ul
£192.50
A1316-50ul 50ul
£113.75
A1316-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1316
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IL1A; IL-1A; IL1; IL1-ALPHA; IL1F1; interleukin-1 alpha
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 112-271 of human IL1A (NP_000566.3).
Reactivity Human, Mouse
Gene ID 3552
Calculated MW 30kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents