IGF2BP1 Polyclonal AntibodyIGF2BP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

IGF2BP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13581-200ul 200ul
£332.50
A13581-100ul 100ul
£192.50
A13581-50ul 50ul
£113.75
A13581-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13581
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IGF2BP1; CRD-BP; CRDBP; IMP-1; IMP1; VICKZ1; ZBP1; insulin-like growth factor 2 mRNA-binding protein 1
Applications IF, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 480 to the C-terminus of human IGF2BP1 (NP_006537.3).
Reactivity Human, Mouse, Rat
Gene ID 10642
Calculated MW 48kDa/63kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200|IP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents