IFT81 Polyclonal AntibodyIFT81 Polyclonal Antibody
Move your mouse over image or click to enlarge

IFT81 Polyclonal Antibody

Cat# Size Price Qty Buy
A4662-200ul 200ul
£332.50
A4662-100ul 100ul
£192.50
A4662-50ul 50ul
£113.75
A4662-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4662
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IFT81; CDV-1; CDV-1R; CDV1; CDV1R; DV1; intraflagellar transport 81
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 550-676 of human IFT81 (NP_054774.2).
Reactivity Human, Mouse, Rat
Gene ID 28981
Calculated MW 12kDa/50kDa/79kDa
Observed MW 79kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents