IDH3G Polyclonal AntibodyIDH3G Polyclonal Antibody
Move your mouse over image or click to enlarge

IDH3G Polyclonal Antibody

Cat# Size Price Qty Buy
A13745-200ul 200ul
£332.50
A13745-100ul 100ul
£192.50
A13745-50ul 50ul
£113.75
A13745-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13745
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names IDH3G; H-IDHG; isocitrate dehydrogenase 3 (NAD(+)) gamma
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human IDH3G (NP_004126.1).
Reactivity Human, Mouse, Rat
Gene ID 3421
Calculated MW 41kDa/42kDa
Observed MW 43kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents