HP Polyclonal AntibodyHP Polyclonal Antibody
Move your mouse over image or click to enlarge

HP Polyclonal Antibody

Cat# Size Price Qty Buy
A14186-200ul 200ul
£332.50
A14186-100ul 100ul
£192.50
A14186-50ul 50ul
£113.75
A14186-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14186
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HP; BP; HP2ALPHA2; HPA1S; haptoglobin
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 123-347 of human HP (NP_001119574.1).
Reactivity Human, Mouse
Gene ID 3240
Calculated MW 38kDa/45kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence HHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents