HAVCR2 Polyclonal AntibodyHAVCR2 Polyclonal Antibody
Move your mouse over image or click to enlarge

HAVCR2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13444-200ul 200ul
£332.50
A13444-100ul 100ul
£192.50
A13444-50ul 50ul
£113.75
A13444-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13444
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names HAVCR2; CD366; HAVcr-2; KIM-3; TIM3; TIMD-3; TIMD3; Tim-3; hepatitis A virus cellular receptor 2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HAVCR2 (NP_116171.3).
Reactivity Human, Mouse
Gene ID 84868
Calculated MW 16kDa/33kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENV
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents