GRIK4 Polyclonal AntibodyGRIK4 Polyclonal Antibody
Move your mouse over image or click to enlarge

GRIK4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13800-200ul 200ul
£332.50
A13800-100ul 100ul
£192.50
A13800-50ul 50ul
£113.75
A13800-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13800
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GRIK4; EAA1; GRIK; GluK4; KA1; glutamate receptor ionotropic, kainate 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-220 of human GRIK4 (NP_055434.2).
Reactivity Human, Mouse, Rat
Gene ID 2900
Calculated MW 107kDa
Observed MW 100kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHAN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents