GREM2 Polyclonal AntibodyGREM2 Polyclonal Antibody
Move your mouse over image or click to enlarge

GREM2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14291-200ul 200ul
£332.50
A14291-100ul 100ul
£192.50
A14291-50ul 50ul
£113.75
A14291-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14291
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GREM2; CKTSF1B2; DAND3; PRDC; STHAG9; gremlin-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human GREM2 (NP_071914.3).
Reactivity Mouse, Rat
Gene ID 64388
Calculated MW 19kDa
Observed MW 19kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIKEVLASSQEAL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents