GPR4 Polyclonal AntibodyGPR4 Polyclonal Antibody
Move your mouse over image or click to enlarge

GPR4 Polyclonal Antibody

Cat# Size Price Qty Buy
A15998-20ul 20ul
£77.00
A15998-50ul 50ul
£113.75
A15998-100ul 100ul
£192.50
A15998-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15998
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GPR4; G-protein coupled receptor 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 283-362 of human GPR4 (NP_005273.1).
Reactivity Human
Gene ID 2828
Calculated MW 40kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PILYCLVNEGARSDVAKALHNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAATPPSQGDQVQLKMLPPAQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents