GPIHBP1 Polyclonal AntibodyGPIHBP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

GPIHBP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13240-200ul 200ul
£332.50
A13240-100ul 100ul
£192.50
A13240-50ul 50ul
£113.75
A13240-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13240
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GPIHBP1; GPI-HBP1; HYPL1D; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human GPIHBP1 (NP_835466.2).
Reactivity Human
Gene ID 338328
Calculated MW 19kDa
Observed MW 20kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents