GPC3 Polyclonal AntibodyGPC3 Polyclonal Antibody
Move your mouse over image or click to enlarge

GPC3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13988-500uL 500uL
£787.50
A13988-200ul 200ul
£332.50
A13988-100ul 100ul
£192.50
A13988-50ul 50ul
£113.75
A13988-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13988
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GPC3; DGSX; GTR2-2; MXR7; OCI-5; SDYS; SGB; SGBS; SGBS1; glypican-3
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 290-550 of human GPC3 (NP_004475.1).
Reactivity Human, Mouse, Rat
Gene ID 2719
Calculated MW 59kDa/65kDa/68kDa
Observed MW 66kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEIS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents