GOLIM4 Polyclonal AntibodyGOLIM4 Polyclonal Antibody
Move your mouse over image or click to enlarge

GOLIM4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14478-200ul 200ul
£332.50
A14478-100ul 100ul
£192.50
A14478-50ul 50ul
£113.75
A14478-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14478
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GOLIM4; GIMPC; GOLPH4; GPP130; P138; Golgi integral membrane protein 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-300 of human GOLIM4 (NP_055313.1).
Reactivity Human, Mouse
Gene ID 27333
Calculated MW 81kDa
Observed MW 130kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELKKQHSDLEEEHRKQGEDFSRTFNDHKQKYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQNHEAVPGRAE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents