GHRL Polyclonal AntibodyGHRL Polyclonal Antibody
Move your mouse over image or click to enlarge

GHRL Polyclonal Antibody

Cat# Size Price Qty Buy
A1338-200ul 200ul
£332.50
A1338-100ul 100ul
£192.50
A1338-50ul 50ul
£113.75
A1338-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1338
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GHRL; MTLRP; appetite-regulating hormone
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human GHRL (NP_057446.1).
Reactivity Human
Gene ID 51738
Calculated MW 7kDa/9kDa/11kDa/12kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents