GAN Polyclonal AntibodyGAN Polyclonal Antibody
Move your mouse over image or click to enlarge

GAN Polyclonal Antibody

Cat# Size Price Qty Buy
A4205-200ul 200ul
£332.50
A4205-100ul 100ul
£192.50
A4205-50ul 50ul
£113.75
A4205-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4205
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names GAN; GAN1; KLHL16; gigaxonin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human GAN (NP_071324.1).
Reactivity Human, Mouse
Gene ID 8139
Calculated MW 67kDa
Observed MW 71kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAEGSAVSDPQHAARLLRALSSFREESRFCDAHLVLDGEEIPVQKNILAAASPYIRTKLNYNPPKDDGSTYKIELEGISVMVMREILDYIFSGQIRLNEDTIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLEKLNVGNERYVFEAVIRWIAHDTEIRKVHMKDVMSALWVSGLDSSYLREQMLNEPL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents