FUT10 Polyclonal AntibodyFUT10 Polyclonal Antibody
Move your mouse over image or click to enlarge

FUT10 Polyclonal Antibody

Cat# Size Price Qty Buy
A13872-200ul 200ul
£332.50
A13872-100ul 100ul
£192.50
A13872-50ul 50ul
£113.75
A13872-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13872
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FUT10; FUCTX; fucosyltransferase 10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-479 of human FUT10 (NP_116053.3).
Reactivity Mouse
Gene ID 84750
Calculated MW 10kDa/41kDa/45kDa/48kDa/52kDa/56kDa/60kDa
Observed MW 56kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NIDSLPLPRKAHHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLPLTTQYLESIEVLKSLRYLVPLQSKNKLRKRLAPLVYVQSDCDPPSDRDSYVRELMTYIEVDSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAFENAVCDDYITEKFWRPLKLGVVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAYVEWKLKGEISNQRLLTALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSCPEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents