FURIN Polyclonal AntibodyFURIN Polyclonal Antibody
Move your mouse over image or click to enlarge

FURIN Polyclonal Antibody

Cat# Size Price Qty Buy
A13335-200ul 200ul
£332.50
A13335-100ul 100ul
£192.50
A13335-50ul 50ul
£113.75
A13335-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13335
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FURIN; FUR; PACE; PCSK3; SPC1; furin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-370 of human FURIN (NP_002560.1).
Reactivity Human, Mouse, Rat
Gene ID 5045
Calculated MW 86kDa
Observed MW 87kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSAS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents