FMO2 Polyclonal AntibodyFMO2 Polyclonal Antibody
Move your mouse over image or click to enlarge

FMO2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3864-200ul 200ul
£332.50
A3864-100ul 100ul
£192.50
A3864-50ul 50ul
£113.75
A3864-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3864
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FMO2; FMO1B1; flavin containing monooxygenase 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-470 of human FMO2 (NP_001451.2).
Reactivity Human
Gene ID 2327
Calculated MW 53kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VFISTRHGTWVMSRISEDGYPWDSVFHTRFRSMLRNVLPRTAVKWMIEQQMNRWFNHENYGLEPQNKYIMKEPVLNDDVPSRLLCGAIKVKSTVKELTETSAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMVSLYKYIFPAHLDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLFGESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCNS
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents