FIBP Polyclonal AntibodyFIBP Polyclonal Antibody
Move your mouse over image or click to enlarge

FIBP Polyclonal Antibody

Cat# Size Price Qty Buy
A13572-200ul 200ul
£332.50
A13572-100ul 100ul
£192.50
A13572-50ul 50ul
£113.75
A13572-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13572
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FIBP; FGFIBP; FIBP-1; TROFAS; FGF1 intracellular binding protein
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-364 of human FIBP (NP_004205.2).
Reactivity Human, Mouse
Gene ID 9158
Calculated MW 41kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents