FCGR3B Polyclonal AntibodyFCGR3B Polyclonal Antibody
Move your mouse over image or click to enlarge

FCGR3B Polyclonal Antibody

Cat# Size Price Qty Buy
A13980-200ul 200ul
£332.50
A13980-100ul 100ul
£192.50
A13980-50ul 50ul
£113.75
A13980-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13980
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FCGR3B; CD16; CD16b; FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb; Fc fragment of IgG receptor IIIb
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-233 of human FCGR3B (NP_000561.3).
Reactivity Human, Rat
Gene ID 2215
Calculated MW 26kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents