FBXO32 Polyclonal AntibodyFBXO32 Polyclonal Antibody
Move your mouse over image or click to enlarge

FBXO32 Polyclonal Antibody

Cat# Size Price Qty Buy
A3193-200ul 200ul
£332.50
A3193-100ul 100ul
£192.50
A3193-50ul 50ul
£113.75
A3193-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3193
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FBXO32; Fbx32; MAFbx; F-box protein 32
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 206-355 of human FBXO32 (NP_478136.1).
Reactivity Mouse, Rat
Gene ID 114907
Calculated MW 27kDa/42kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence WQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Sensitivity WB,1:1000 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents