FBL Polyclonal AntibodyFBL Polyclonal Antibody
Move your mouse over image or click to enlarge

FBL Polyclonal Antibody

Cat# Size Price Qty Buy
A13490-200ul 200ul
£332.50
A13490-100ul 100ul
£192.50
A13490-50ul 50ul
£113.75
A13490-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13490
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names FBL; FIB; FLRN; RNU3IP1; Nop1; fibrillarin
Applications IF, IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-321 of human FBL (NP_001427.2).
Reactivity Human, Monkey, Mouse, Rat
Gene ID 2091
Calculated MW 33kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200|IP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents