F7 Polyclonal AntibodyF7 Polyclonal Antibody
Move your mouse over image or click to enlarge

F7 Polyclonal Antibody

Cat# Size Price Qty Buy
A16044-20ul 20ul
£77.00
A16044-50ul 50ul
£113.75
A16044-100ul 100ul
£192.50
A16044-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16044
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names F7; SPCA; coagulation factor VII
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-400 of human F7 (NP_062562.1).
Reactivity Human, Mouse, Rat
Gene ID 2155
Calculated MW 49kDa/51kDa
Observed MW 46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTGIV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents