ERCC5 Polyclonal AntibodyERCC5 Polyclonal Antibody
Move your mouse over image or click to enlarge

ERCC5 Polyclonal Antibody

Cat# Size Price Qty Buy
A1605-20ul 20ul
£77.00
A1605-50ul 50ul
£113.75
A1605-100ul 100ul
£192.50
A1605-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1605
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ERCC5; COFS3; ERCC5-201; ERCM2; UVDR; XPG; XPGC; ERCC excision repair 5, endonuclease
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human ERCC5 (NP_000114.2).
Reactivity Human, Mouse, Rat
Gene ID 2073
Calculated MW 27kDa/47kDa/133kDa
Observed MW 133kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFHRLCKLLFFRIRPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIKTAFRSKRDEALPSLTQVRRENDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFFHNPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEG
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents