ERBB3 Polyclonal AntibodyERBB3 Polyclonal Antibody
Move your mouse over image or click to enlarge

ERBB3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13976-200ul 200ul
£332.50
A13976-100ul 100ul
£192.50
A13976-50ul 50ul
£113.75
A13976-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13976
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ERBB3; ErbB-3; HER3; LCCS2; MDA-BF-1; c-erbB-3; c-erbB3; erbB3-S; p180-ErbB3; p45-sErbB3; p85-sErbB3; erb-b2 receptor tyrosine kinase 3
Applications IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-285 of human ERBB3 (NP_001973.2).
Reactivity Mouse, Rat
Gene ID 2065
Calculated MW 20kDa/36kDa/77kDa/141kDa/148kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGV
Sensitivity IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents