EDIL3 Polyclonal AntibodyEDIL3 Polyclonal Antibody
Move your mouse over image or click to enlarge

EDIL3 Polyclonal Antibody

Cat# Size Price Qty Buy
A4370-200ul 200ul
£332.50
A4370-100ul 100ul
£192.50
A4370-50ul 50ul
£113.75
A4370-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4370
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EDIL3; DEL1; EGF like repeats and discoidin domains 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-300 of human EDIL3 (NP_005702.3).
Reactivity Human
Gene ID 10085
Calculated MW 52kDa/53kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQV
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents