DPF2 Polyclonal AntibodyDPF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

DPF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13271-200ul 200ul
£332.50
A13271-100ul 100ul
£192.50
A13271-50ul 50ul
£113.75
A13271-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13271
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DPF2; REQ; UBID4; ubi-d4; double PHD fingers 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 126-391 of human DPF2 (NP_006259.1).
Reactivity Human, Mouse, Rat
Gene ID 5977
Calculated MW 23kDa/44kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents