DNAJC2 Polyclonal AntibodyDNAJC2 Polyclonal Antibody
Move your mouse over image or click to enlarge

DNAJC2 Polyclonal Antibody

Cat# Size Price Qty Buy
A4633-200ul 200ul
£332.50
A4633-100ul 100ul
£192.50
A4633-50ul 50ul
£113.75
A4633-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4633
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DNAJC2; MPHOSPH11; MPP11; ZRF1; ZUO1; dnaJ homolog subfamily C member 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human DNAJC2 (NP_055192.1).
Reactivity Human, Mouse
Gene ID 27000
Calculated MW 65kDa/71kDa
Observed MW 72kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents