Defb26 Polyclonal AntibodyDefb26 Polyclonal Antibody
Move your mouse over image or click to enlarge

Defb26 Polyclonal Antibody

Cat# Size Price Qty Buy
A15903-20ul 20ul
£77.00
A15903-50ul 50ul
£113.75
A15903-100ul 100ul
£192.50
A15903-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15903
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DEFB126; C20orf8; DEFB-26; DEFB26; HBD26; bA530N10.1; hBD-26; beta-defensin 126
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-128 of rat Defb26 (NP_001032595.1).
Reactivity Human
Gene ID 641629
Calculated MW 14kDa
Physical Appearance liquid
Purification Affinity purification
Sequence WRRMPPKCWKDNLGRCRVRCRGDERYIYLCRNKANCCILLTLAEDQSAHPKPTSVHPENVTWKNTSISPTTRYIDDITLDKTSIGTPTNVAGIGKALNLTVITPTHP
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents