DDB1 Polyclonal AntibodyDDB1 Polyclonal Antibody
Move your mouse over image or click to enlarge

DDB1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3827-200ul 200ul
£332.50
A3827-100ul 100ul
£192.50
A3827-50ul 50ul
£113.75
A3827-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3827
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DDB1; DDBA; UV-DDB1; XAP1; XPCE; XPE; XPE-BF; DNA damage-binding protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human DDB1 (NP_001914.3).
Reactivity Human, Mouse, Rat
Gene ID 1642
Calculated MW 50kDa/126kDa
Observed MW 127kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents