DCT Polyclonal AntibodyDCT Polyclonal Antibody
Move your mouse over image or click to enlarge

DCT Polyclonal Antibody

Cat# Size Price Qty Buy
A16041-20ul 20ul
£77.00
A16041-50ul 50ul
£113.75
A16041-100ul 100ul
£192.50
A16041-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16041
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DCT; TRP-2; TYRP2; dopachrome tautomerase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-350 of human DCT (NP_001913.2).
Reactivity Human, Mouse
Gene ID 1638
Calculated MW 59kDa/62kDa
Observed MW 59kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30290020
Sequence NVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents