Cytochrome c Polyclonal AntibodyCytochrome c Polyclonal Antibody
Move your mouse over image or click to enlarge

Cytochrome c Polyclonal Antibody

Cat# Size Price Qty Buy
A13430-200ul 200ul
£332.50
A13430-100ul 100ul
£192.50
A13430-50ul 50ul
£113.75
A13430-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13430
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CYCS; CYC; HCS; THC4; cytochrome c
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human Cytochrome c (NP_061820.1).
Reactivity Human, Mouse, Rat
Gene ID 54205
Calculated MW 11kDa
Observed MW 14kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 29956756
Sequence MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents