CYP17A1 Polyclonal AntibodyCYP17A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CYP17A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13968-200ul 200ul
£332.50
A13968-100ul 100ul
£192.50
A13968-50ul 50ul
£113.75
A13968-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13968
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CYP17A1; CPT7; CYP17; P450C17; S17AH; steroid 17-alpha-hydroxylase/17,20 lyase
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 209-508 of human CYP17A1 (NP_000093.1).
Reactivity Rat
Gene ID 1586
Calculated MW 57kDa
Observed MW 57kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents