| Cat# | Size | Price | Qty | Buy |
|---|---|---|---|---|
| A12534-200ul | 200ul |
£332.50
|
||
| A12534-100ul | 100ul |
£192.50
|
||
| A12534-50ul | 50ul |
£113.75
|
||
| A12534-20ul | 20ul |
£77.00
|
Additional Information
| Property | Value or Rating |
|---|---|
| Manufacturer Cat# | A12534 |
| Manufacturer | Abclonal Biotechnology |
| Antibody Type | Polyclonal |
| Alternate Names | CXCR4; CD184; D2S201E; FB22; HM89; HSY3RR; LAP-3; LAP3; LCR1; LESTR; NPY3R; NPYR; NPYRL; NPYY3R; WHIM; WHIMS; C-X-C chemokine receptor type 4 |
| Applications | IHC, WB |
| Buffer | Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Conjugate | Unconjugated |
| Host | Rabbit |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-42 of human CXCR4 (NP_001008540.1). |
| Reactivity | Human, Mouse, Rat |
| Gene ID | 7852 |
| Calculated MW | 39kDa/40kDa |
| Observed MW | 60kDa |
| Physical Appearance | liquid |
| Purification | Affinity purification |
| Sequence | MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNK |
| Sensitivity | WB,1:500 - 1:2000|IHC,1:50 - 1:200 |
| Storage | Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
