CXCL12 Polyclonal AntibodyCXCL12 Polyclonal Antibody
Move your mouse over image or click to enlarge

CXCL12 Polyclonal Antibody

Cat# Size Price Qty Buy
A1325-200ul 200ul
£332.50
A1325-100ul 100ul
£192.50
A1325-50ul 50ul
£113.75
A1325-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1325
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CXCL12; IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1; stromal cell-derived factor 1
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-89 of human CXCL12 (NP_954637.1).
Reactivity Human, Mouse, Rat
Gene ID 6387
Calculated MW 10kDa/11kDa/13kDa/15kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Sensitivity WB,1:200 - 1:500|IHC,1:100 - 1:200|IF,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents