COX6A1 Polyclonal AntibodyCOX6A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

COX6A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3798-200ul 200ul
£332.50
A3798-100ul 100ul
£192.50
A3798-50ul 50ul
£113.75
A3798-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3798
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names COX6A1; CMTRID; COX6A; COX6AL; cytochrome c oxidase subunit 6A1
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-109 of human COX6A1 (NP_004364.2).
Reactivity Human, Mouse, Rat
Gene ID 1337
Calculated MW 12kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
Sensitivity WB,1:200 - 1:2000|IHC,1:20 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents