CHST11 Polyclonal AntibodyCHST11 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHST11 Polyclonal Antibody

Cat# Size Price Qty Buy
A13734-200ul 200ul
£332.50
A13734-100ul 100ul
£192.50
A13734-50ul 50ul
£113.75
A13734-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13734
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHST11; C4ST; C4ST-1; C4ST1; HSA269537; carbohydrate sulfotransferase 11
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 38-352 of human CHST11 (NP_060883.1).
Reactivity Human, Rat
Gene ID 50515
Calculated MW 41kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNISFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents