CHRNA7 Polyclonal AntibodyCHRNA7 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHRNA7 Polyclonal Antibody

Cat# Size Price Qty Buy
A1588-20ul 20ul
£77.00
A1588-50ul 50ul
£113.75
A1588-100ul 100ul
£192.50
A1588-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1588
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHRNA7; CHRNA7-2; NACHRA7; cholinergic receptor nicotinic alpha 7 subunit
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-230 of human CHRNA7 (NP_001177384.1).
Reactivity Human, Mouse, Rat
Gene ID 1139
Calculated MW 11kDa/56kDa/59kDa
Observed MW 53kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ASPPSTPPWDPGHIPGASVRPAPGPVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGI
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents