CHRM3 Polyclonal AntibodyCHRM3 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHRM3 Polyclonal Antibody

Cat# Size Price Qty Buy
A1602-20ul 20ul
£77.00
A1602-50ul 50ul
£113.75
A1602-100ul 100ul
£192.50
A1602-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1602
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHRM3; EGBRS; HM3; PBS; cholinergic receptor muscarinic 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 390-475 of human CHRM3 (NP_000731.1).
Reactivity Mouse, Rat
Gene ID 1131
Calculated MW 66kDa
Observed MW 66kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30120910 |30212637
Sequence QVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents