CHRM1 Polyclonal AntibodyCHRM1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHRM1 Polyclonal Antibody

Cat# Size Price Qty Buy
A1598-20ul 20ul
£77.00
A1598-50ul 50ul
£113.75
A1598-100ul 100ul
£192.50
A1598-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1598
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHRM1; HM1; M1; M1R; cholinergic receptor muscarinic 1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CHRM1 (NP_000729.2).
Reactivity Human, Mouse, Rat
Gene ID 1128
Calculated MW 50kDa/51kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence WELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents