CHMP7 Polyclonal AntibodyCHMP7 Polyclonal Antibody
Move your mouse over image or click to enlarge

CHMP7 Polyclonal Antibody

Cat# Size Price Qty Buy
A14334-200ul 200ul
£332.50
A14334-100ul 100ul
£192.50
A14334-50ul 50ul
£113.75
A14334-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14334
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CHMP7; charged multivesicular body protein 7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 204-453 of human CHMP7 (NP_689485.1).
Reactivity Mouse
Gene ID 91782
Calculated MW 18kDa/50kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LQKEKRVTVLEQNGEKIVKFARGPRAKVSPVNDVDVGVYQLMQSEQLLSRKVESLSQEAERCKEEARRACRAGKKQLALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDEVSQTLAGGVTNGLDFDSEELEKELDILLQDTTKEPLDLPDNPRNRHFTNSVPNPRISDAELEAELEKLSLSEGGLVPSSKSPKRQLEPTLKPL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents