CES2 Polyclonal AntibodyCES2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CES2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13640-200ul 200ul
£332.50
A13640-100ul 100ul
£192.50
A13640-50ul 50ul
£113.75
A13640-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13640
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CES2; CE-2; CES2A1; PCE-2; iCE; cocaine esterase
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 310-410 of human CES2 (NP_003860.3).
Reactivity Human, Mouse
Gene ID 8824
Calculated MW 59kDa/61kDa
Observed MW 57kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEM
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents