CERK Polyclonal AntibodyCERK Polyclonal Antibody
Move your mouse over image or click to enlarge

CERK Polyclonal Antibody

Cat# Size Price Qty Buy
A15889-20ul 20ul
£77.00
A15889-50ul 50ul
£113.75
A15889-100ul 100ul
£192.50
A15889-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15889
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CERK; LK4; dA59H18.2; dA59H18.3; hCERK; ceramide kinase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CERK (NP_073603.2).
Reactivity Human, Mouse, Rat
Gene ID 64781
Calculated MW 37kDa/59kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents